PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009103540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 335aa    MW: 35322.7 Da    PI: 8.0609
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009103540.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702217.62.8e-671242674154
          DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskk 98 
                     g+ sCqdCGnqakkdCah+RCRtCCksrg++C thvkstWvpaakrrerqqqla++++ +     e+ +kr+re+    +++   t+l+ ++++ 
  XP_009103540.1 124 GGPSCQDCGNQAKKDCAHMRCRTCCKSRGLECPTHVKSTWVPAAKRRERQQQLASSQHPQ----GENVPKRPREHFPVPAKS---TSLVCTHNTL 211
                     6789**************************************************997776....568999999985544443...4444455567 PP

          DUF702  99 eletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      l++ ++P+e+ss+a f+cvrvssvd+ge+e+aY+tavsigGhvfkGiLydqG++e
  XP_009103540.1 212 GLQVGNFPPEISSSATFQCVRVSSVDEGEDEYAYKTAVSIGGHVFKGILYDQGPAE 267
                     999**************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.7E-63125266IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.0E-27127169IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.1E-25218265IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MAGFFSLGNG TGVDGGGSRQ DATTTNTNNN SSPSGNESWL WCRNPNSNAN AGGGDIAPSY  60
KGTLELWQHS NNQQIIFQQQ QQQRLNLYTS AAGLGVGPSN RSLIEASGGE ASGLTMMRSG  120
GGGGGPSCQD CGNQAKKDCA HMRCRTCCKS RGLECPTHVK STWVPAAKRR ERQQQLASSQ  180
HPQGENVPKR PREHFPVPAK STSLVCTHNT LGLQVGNFPP EISSSATFQC VRVSSVDEGE  240
DEYAYKTAVS IGGHVFKGIL YDQGPAERSS SDGGSQPLNL ITAGPSASSS SAKVSCNNGV  300
VGSTSDHYID PASLNYPTSN NSFITGTHFF SNPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103540.10.0PREDICTED: protein SHORT INTERNODES
SwissprotQ9XGX01e-170SHI_ARATH; Protein SHORT INTERNODES
TrEMBLA0A078I7270.0A0A078I727_BRANA; BnaA07g12710D protein
STRINGAT5G66350.11e-168(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.11e-161Lateral root primordium (LRP) protein-related